DPCstruct | MC7738
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 123 ± 10 aa |
| Standard deviation of domain lengths | 9.96 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07899 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A396JHM8 | 13-116 | CEMFNFVKHLINRKQIVAAVRFSCAYNLDDKDHLVDMLREHVQNVKLICESSCKKTNSIEIKDKARDQEIASLGTVLQCISDNNLES… |
| A0A2P6R6F2 | 1-127 | MVLDVIRILIERKQLIEAVRFIGTFKLTDKFPPAPLLNEYVEDAEKWWSETFSQKKSLDKKENAVDDRITNLRVVVQCVEEYNLQSE… |
| A0A443N775 | 279-410 | None |
| A0A438K0H6 | 8-118 | None |
| A0A0L9UDU4 | 21-152 | None |
| A0A6P4B5C4 | 106-222 | None |
| A0A314XPM3 | 58-174 | None |
| A0A251NZA3 | 58-195 | None |
| A0A438EY48 | 202-327 | None |
| A0A6J5XP38 | 126-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.