DPCstruct | MC7736
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 65 ± 6 aa |
| Standard deviation of domain lengths | 5.53 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 63.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01992 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060SAQ5 | 2-64 | EALFFNVDSGFLEGIVRGYKAGLLTQNQYNNLTQCETIEDFRTQLSATDYGNFLANEPLPIST |
| A0A2P6R0P5 | 1-76 | MYGFEAMTFNIHGGYLEAIIRGHRAGLLTTADYNNLYQCETHDDIKMHLFATEYSPYLQNGALWNYISLSYRGFVF |
| A0A6A6M919 | 1-69 | None |
| A0A6A5MZS4 | 1-60 | None |
| A0A7S3E900 | 6-67 | None |
| A0A087SFC4 | 1-62 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.