DPCstruct | MC7735
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 224 ± 19 aa |
| Standard deviation of domain lengths | 18.87 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 43.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9HSX0 | 1-246 | MEVVTQLNCTIWDSILEQTKVAQEQGSDPFLWSIQVSSNLSSFGISLPSLELANHLVSHLCWENNVPIAWKFLEKALTLKIVPPFLV… |
| A0A2P6QXF9 | 2-242 | AFFEQSSLWDNVIQETKEAQEKGSDPLLWSVEVSSILSSAGVSLPSTELANVMVSYICWENNVPILWKFLEKAMVYNMVPSMLVLAL… |
| A0A6A6M1A2 | 10-231 | None |
| A0A0A0KG79 | 10-255 | None |
| A0A453BKX4 | 1-211 | None |
| A0A178VLL7 | 9-204 | None |
| A0A6D2HAK9 | 1-243 | None |
| A0A699IG24 | 1-230 | None |
| A0A803MR12 | 12-203 | None |
| A0A1D6IMQ1 | 2-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.