DPCstruct | MC7733
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 73 ± 5 aa |
| Standard deviation of domain lengths | 4.77 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 28.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J6H7Y3 | 17-84 | EQMSKIYIGPTISKYHLLENSVYLNIYPNNVQEAIQEYPIAAKLFIEIEKIHERNSEQNKIYYDLLKE |
| D1Y706 | 1-78 | MAEQMIYCGPAVPRGGLSAFAVFAGALPANVRKLAGECPELGRLIVPVGDLAETRRRVGEPGTEERRLYEAVKNHKWE |
| A0A3A9BK40 | 11-87 | None |
| A0A1Y3RS55 | 34-105 | None |
| A0A3A9EPN5 | 30-107 | None |
| A0A3A9EP92 | 145-218 | None |
| W8YPD7 | 1-66 | None |
| A0A7X4Z3P2 | 1-65 | None |
| A0A4R3D8C9 | 1-82 | None |
| A0A839TXW9 | 3-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.