DPCstruct | MC773
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 159 ± 14 aa |
| Standard deviation of domain lengths | 14.04 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0265 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X0W699 | 4-163 | LIDAFVTQVIENSDYTIDDHFYLRNRILALTGEAGANQETARTTLISLRDALVDVAVDNGKVGDLTEERDTLGAALMDFITPAPSVL… |
| A0A356PSX6 | 20-161 | IEKEDEIYTRNRIMTVLSLDSFEDAEPKKDAELEDILSVILQYAEENGLCESSVVYRDLFDTKVMGTLVARPSDIIAEFRKKYSVSP… |
| A0A1H9EQC8 | 385-566 | None |
| A0A654XKU3 | 1-136 | None |
| A0A7Z2HVG3 | 22-177 | None |
| A0A429ZEQ6 | 1-143 | None |
| A0A380KE28 | 1-162 | None |
| A0A4L7JTD2 | 221-381 | None |
| D4YH11 | 2-163 | None |
| A0A845EJH9 | 335-500 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.