DPCstruct | MC7729
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 175 ± 29 aa |
| Standard deviation of domain lengths | 29.23 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 25.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B0P0D8 | 4-128 | KKHRTEIIANSSPESMERHMLSLHVILRMVEESIPGGILTPRPDIYGVGEVGKMKKGEVEKLMAELLSVCWKHLKRIDLLLSELRNR… |
| A0A0L0V4M1 | 15-155 | LRANQRLYTSARFAVKEAIGVLKAKNRQIEVAASASPTNMATFMTSTHAILRMVEEATPGSTLTHLATLPGVTEAHRMNAKEIAALV… |
| H6QSV2 | 1-120 | None |
| A0A5B0QAP1 | 497-706 | None |
| A0A180G2A5 | 104-223 | None |
| A0A2N5VYS2 | 330-524 | None |
| A0A2N5VGA1 | 166-369 | None |
| A0A2S4WC01 | 23-204 | None |
| A0A180H2D6 | 87-270 | None |
| H6QQP4 | 249-434 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.