DPCstruct | MC7727
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 133 ± 25 aa |
| Standard deviation of domain lengths | 24.83 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 74.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S4VNI5 | 1-82 | MCCFCDECLPQNLSACFMKTNQELRALPEVRSRKEAKNPLALYLPFSQRAKQVQLHKAELTTIPDGIKQGWPTHIEFNKLHR |
| A0A0L0UQH5 | 21-164 | GCRHHQQDNHRYAAREINLLAHMKATLQSRGLAWQGPRDRPVAESEELPLAEEVEEANNGVPICCFCDEPIPHHPSEKFTKLTDYFQ… |
| A0A2R6NX49 | 615-755 | None |
| A0A2S4WH11 | 107-260 | None |
| A0A1E3JCJ3 | 386-555 | None |
| A0A4Y9YSH0 | 1-149 | None |
| A0A0L6VHX8 | 23-144 | None |
| F4RNU1 | 1-106 | None |
| F4RTJ5 | 103-238 | None |
| J0LD35 | 8-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.