DPCstruct | MC7726
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 159 ± 30 aa |
| Standard deviation of domain lengths | 30.16 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A562HKK9 | 8-209 | YRCFFEQLARRGFDVKRSTSSDYLADIYYKNQLIAFYTKADTVERNPFVEVKDKVFNLVEETARKTAVESGICTECPYTDKEERLKN… |
| A0A417KY54 | 9-176 | LKELLEYIGLDLRMDDKESEYSIICDAEGIAYARVRDGGYHINDSVPLEKEYQIQDAIQRAYGFRVQFERSESLDSLGVNGYRKIGG… |
| A0A4R2LJW1 | 1-141 | None |
| A0A4U7JDR2 | 7-142 | None |
| A0A174WEQ8 | 5-177 | None |
| A0A1H0F0E9 | 147-300 | None |
| A0A410Q1F3 | 5-162 | None |
| A0A645FTC8 | 1-178 | None |
| A0A1Y4HEU3 | 3-129 | None |
| A0A318Y1G7 | 8-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.