DPCstruct | MC7722
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 88 ± 11 aa |
| Standard deviation of domain lengths | 11.07 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H5CNK4 | 2-66 | DTPRRFAIVEDFEDGRESMVVGWGCEFTDRADFVSEDGRMLMTSSSAESTRDLLGITGDMRLVWP |
| A0A4Q8B2W2 | 51-132 | PRFAELLRGIVADHAPHVFAIVQEYGERVDGRVAAWGMAFDERAEIVTVEGDVRMSLRSPEAALPNFRFGTRIRSRLVWFDR |
| A0A495W2C6 | 23-108 | None |
| C6WL18 | 21-114 | None |
| A0A5B2WNJ9 | 1-89 | None |
| A0A5B2WIJ6 | 2-98 | None |
| A0A4P6Q3W5 | 11-100 | None |
| A0A4V3FTF7 | 16-103 | None |
| A0A428WQY1 | 2-85 | None |
| A0A1W2D7D1 | 4-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.