DPCstruct | MC7720
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 119 ± 21 aa |
| Standard deviation of domain lengths | 21.30 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 14.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07024 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A349UMJ7 | 67-164 | KPAADLDRVLLANGDELFGRATDKTIRLATEFCAEPMSISTGNVRALELSPTHIARAAVQMWDGTVLRGELSPAALTFAVAGGPTLR… |
| A0A3C1G4U0 | 197-311 | LLQAETPAKSKTENSYWDVTDCNGQKSRLRNLRFDGKDYLCGIFGNGELRVPVINFASMDLYREQQQVSATLSDKNGEKVTLKIDGD… |
| A0A7V2U9L9 | 13-109 | None |
| A0A554J6A1 | 252-344 | None |
| A0A6B2FNQ8 | 132-267 | None |
| A0A1V5NGY9 | 10-136 | None |
| A0A3M1CS79 | 1-131 | None |
| A0A2V6TEB8 | 1-112 | None |
| A0A517M4W3 | 28-140 | None |
| A0A5B9P6F4 | 136-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.