DPCstruct | MC772
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 147 ± 14 aa |
| Standard deviation of domain lengths | 14.48 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5XID4 | 247-369 | SSAMLRMAWTREVGNYLTTNGKAYTAIRVIGDNHDVLNALRLYDKGVLSLEEVIAILRNYLTKVGQVHYLPYYEALLRDTPWKKCSC… |
| A0A7Z9R5X1 | 1-139 | MNNYFSEHEHYTAIRIPQVIETSVKKRIQSGILNQEDVQRAENAALSAVRKYAQREICLSKALENLQTYEDLLFSSRDYSEAYARTL… |
| A0A2D6QUU0 | 266-409 | None |
| A0A7W1A5Z8 | 1-157 | None |
| A0A6P0UUD8 | 270-434 | None |
| W1EN69 | 2-126 | None |
| A0A519RGH6 | 54-196 | None |
| A0A5S9F5R5 | 586-734 | None |
| A0A1V5BMD8 | 422-574 | None |
| A0A661V4M1 | 7-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.