DPCstruct | MC7718
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 111 ± 11 aa |
| Standard deviation of domain lengths | 10.73 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V4GE14 | 419-526 | TEIKALSRWILQRLGPDVPVHFTRFHPMYKLTNLEPTPVATLERCREIARAEGLHFVYLGNVPRHPGENTYCPQCGKILVERLGFTI… |
| A0A3C1G262 | 5-108 | KEMCLWIKKELGPDTPIHFSRFFPLYKLKTLPPTPVSTLEKAREVAYSAGLEYVYIGNIPGHEGENTFCPKCKKMIIQRRGYMMGEI… |
| A0A1V5H4J9 | 523-631 | None |
| A0A831YI57 | 25-151 | None |
| A0A6G0AF98 | 1-89 | None |
| A0A850M6D8 | 244-352 | None |
| A0A3D0Z0M9 | 120-227 | None |
| A0A2V9X3S3 | 241-348 | None |
| A0A836REI2 | 47-164 | None |
| A0A7C0XRI6 | 110-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.