DPCstruct | MC7717
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 228 ± 20 aa |
| Standard deviation of domain lengths | 19.82 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N2Z9W3 | 155-380 | ERYLPIWLKQKYPYDFVGTKYIIQYAFGSTTSTNSAAEYEFNGEEWIKNIGYEIEQRTEQYVYAATGWIFDPTIRFIMERDDYGIIA… |
| R7HRF6 | 9-230 | PDEYLPTYLKVNFPYAKAGDTKLVAYKYYASSKTSLVCDQYTFNGSLWQKTNGVTEESAQFVRTNGKWMYDPNVEITLPGGKGVEIS… |
| A0A6C1QJ95 | 104-275 | None |
| E2NIX4 | 16-269 | None |
| A0A3D5X4A1 | 1-217 | None |
| A0A2P8CH16 | 488-732 | None |
| C2MB44 | 198-425 | None |
| A0A353Z0J2 | 369-601 | None |
| A0A4Y1XAJ8 | 636-877 | None |
| J9GGW4 | 34-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.