DPCstruct | MC7714
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 191 ± 19 aa |
| Standard deviation of domain lengths | 18.55 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1ZA24 | 108-288 | LSRGLGELVGPTYEALVDGVGAASGPDGRYLVQWSDAHFFGSQVYGLISELDDRGLDVGGHPYFTVPLTPERTMPVERATAEVHFAS… |
| A0A6J6JY23 | 8-194 | LTPLRLSESWTRAIAALTPPTLAALEGLPEPIFLVDGYGLDGSAGLDVLAQAEEAGIDVRRGPSWAYIYGDKRTIERSQAASELLFL… |
| A0A848UK21 | 57-271 | None |
| A0A7X7HSW0 | 786-965 | None |
| A0A6J6FN93 | 171-353 | None |
| A0A7W0KUP1 | 21-230 | None |
| A0A6J6SAK4 | 244-447 | None |
| A0A7W0LSD4 | 2-220 | None |
| A0A7W0QH82 | 1-154 | None |
| A0A6J6JUP5 | 281-471 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.