DPCstruct | MC7712
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 163 ± 15 aa |
| Standard deviation of domain lengths | 15.33 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0347 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I3X7Q6 | 2-149 | SDKELVGVKGWLLFLVLSLSVLSILGTIASLGQFSIAEHLYPGLKSVDTWQAFKQWIYILALASLSMRFLSAYRLYYKHEKSSVELA… |
| A0A7Y3FEZ4 | 121-279 | EENKNDEKTDQLIGVHGWLLFFCITLIFLSPLINLVSIIPYLVEDYYFLKSYPLLELVTYADILLSLALLVFGIYVGIKIWTIRPNA… |
| A0A826TR73 | 22-170 | None |
| A0A240UAD3 | 63-246 | None |
| A0A2V6U6E7 | 38-216 | None |
| A0A0N1LC83 | 616-796 | None |
| A0A316FBW0 | 44-217 | None |
| A0A4P8RGH8 | 303-471 | None |
| R7KRR8 | 11-170 | None |
| A0A4R1Y025 | 5-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.