DPCstruct | MC7711
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 183 ± 7 aa |
| Standard deviation of domain lengths | 7.17 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 90.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 24.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C7ZW82 | 390-578 | YDFPAQGLFMGANEFRNIDLKNIRLATRNIARITADGPGVYQAYLMPEQKRNLRVYDAQRDINGKQLVRNDLVDGDPLGADYVLVHF… |
| A0A7Y2K552 | 2-180 | KFTFIARDIQAGNEFRQVDIRNHNLFSAKDVKAQVDGLEFSRFFIPPAAKDLNGGMLFADFKDTYSTYLNVTFSIRPPDDVYGEIFL… |
| A0A355BTA8 | 77-260 | None |
| A0A3C2ANZ5 | 1-194 | None |
| A0A7W2IX33 | 208-389 | None |
| A0A2T2SPX2 | 2-177 | None |
| A0A7X9KRR5 | 8-202 | None |
| A0A7V5SL71 | 457-630 | None |
| A0A0P1MVT8 | 478-653 | None |
| A0A7C6AUN0 | 135-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.