DPCstruct | MC7710
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 191 ± 27 aa |
| Standard deviation of domain lengths | 26.76 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 33.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05700 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453EP07 | 1-159 | NHPMLAKEYERVRAGKPPATMEMSRYGLEPPPANKRNDVLAWRQALRNAQSQLQHQIVRIENLELMLKHGVEVWKLQNRKMESVLSR… |
| A0A182VCL5 | 5-200 | VLVDALPYIDLGYDDPGVREAAIAMVEEECRRYRPTKNYLEHLPALNTTAFETELMAAEFERIQNRLPMEPLSMKRYELPPPPAGKM… |
| G0QIQ0 | 18-217 | None |
| A0A0V0QPT1 | 37-203 | None |
| A0A0V0SB39 | 1-219 | None |
| A0A4Z2CZQ6 | 3-155 | None |
| A0A397UTG9 | 16-209 | None |
| A0A654GXS3 | 78-304 | None |
| A0A1B0ACY3 | 1-138 | None |
| A0A819CC34 | 421-622 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.