DPCstruct | MC771
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 189 ± 22 aa |
| Standard deviation of domain lengths | 21.88 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0466 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6A900 | 1-182 | MRIVQLQGLDLRLLRFDFDLTMAGVFLNADGTVYSRYGARDSQDAMKLNSTKGLAAAMRNVLELHAAYPKNRASLVGKQSPKPRFPR… |
| A0A3A0E0I2 | 318-529 | ACSEFDKALLEDESDVRDLFDKFVCVRVVQGNGLDLALFQFDYDQSFHAMFLSADKTIYGRFGTRSARKEHEDMTMQGLRQTMLAAL… |
| A0A2D5NFY5 | 2-217 | None |
| A0A2E4ZWL3 | 70-242 | None |
| A0A2E0QRS3 | 69-268 | None |
| A0A7W9SPD2 | 44-205 | None |
| A0A7Z9V3C9 | 1-197 | None |
| A0A2S8GEV0 | 77-297 | None |
| A0A7Y1Y388 | 5-175 | None |
| A0A2H6ABF1 | 2-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.