DPCstruct | MC7708
Metacluster Properties and Pfam Annotations
| Number of structural domains | 224 |
|---|---|
| Mean domain length (aa) | 137 ± 33 aa |
| Standard deviation of domain lengths | 32.95 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 82.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.78 |
| Pfam Score | 80.69 |
| Assigned Pfam label(s) | CL0236- CL0476 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y7TRP1 | 15-113 | PANLQERARCGVFRGLWDQGYYMGVGIRFGGEYLVYPGDPLRYHSHFVATVLESPTTMLRPMEIVAHGRLGTATKKSHLLCGWDDEK… |
| A0A182UXU5 | 15-165 | FLMHMLNMLCLKDTRGNTISVAQAFAKFRTVKRNFLACYCAYLYLKSKNWIIKSGIKFGGDFVIYVKGPQFYHASYIVLIQEVFDGA… |
| A0A0B1PDU2 | 211-356 | None |
| X0RHJ6 | 47-182 | None |
| A0A6L5C5C8 | 121-230 | None |
| A0A0F4YJN2 | 213-305 | None |
| A0A0A9PSM8 | 13-129 | None |
| D3AZS6 | 360-533 | None |
| A0A183NZ02 | 140-280 | None |
| A0A0D6R9W3 | 80-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.