DPCstruct | MC7707
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 127 ± 15 aa |
| Standard deviation of domain lengths | 14.51 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 68.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 53.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4J2X6 | 1-122 | MGDRDMPSVPVTTLAGLTSTSDLLSELPVSDSLQSAASLNKSLLFHALVANESSNLLSVRDENLVRQLVNAIEKTNSDNIELKSHYT… |
| A0A7R9GVY3 | 1-114 | MNGEIPSVPITTLAGISSLTDLLPEMPLPSPLPQTLSNKSLLFHPRVAEEAQILLSVRDDALVPQLVQSLVQTTSDHIELKDHYAAT… |
| B0X0A4 | 1-125 | None |
| A0A6P4EIZ3 | 1-137 | None |
| A0A2H6MU96 | 1-109 | None |
| A0A1W4UYX5 | 1-118 | None |
| A0A6P7FZI4 | 1-161 | None |
| A0A6P6NKA3 | 1-127 | None |
| A0A3M0KTJ2 | 1-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.