DPCstruct | MC7704
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 74 ± 6 aa |
| Standard deviation of domain lengths | 6.45 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 45.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P7U5Y7 | 4-69 | ELTVSPGPEEGALRPAGTPNRCVRAGCTNPPVESKDWDKEYCSNECVATHCRDVFMAWCSIRSQNS |
| A0A182UMN6 | 4-70 | QQSCPTSTAEPPAAIPQTCIRQGCNNLAIENPDWEDEYCSQECVVAHCRAVFATFQEDCLKGNAPPQ |
| A0A833VV88 | 231-309 | None |
| A0A0A9YWL7 | 196-273 | None |
| A0A6J8E4Q4 | 129-199 | None |
| A0A7R8D5H1 | 137-203 | None |
| A0A6J0V3Q4 | 421-507 | None |
| A0A2K5K932 | 221-287 | None |
| A0A170Y636 | 73-149 | None |
| A0A834EXQ2 | 418-491 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.