DPCstruct | MC7702
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 72 ± 3 aa |
| Standard deviation of domain lengths | 3.26 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 90.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 55.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z7CJX6 | 132-203 | TGWVPQHIIAKDHSNNILGVIPLYLKSHSSGEYVFDHSWADAYYSYGSRYYPKLQCCVPFTPVTGPRILVRN |
| A0A2P5D000 | 165-236 | TGWMPRHIIAKDETENILGVVPLYLKSHSYGEFVFDHSWADAYYSFGSRYYPKLQCCVPFTPVTGPRILVRN |
| G4MDG7 | 1-73 | None |
| A0A7J8SNC7 | 241-312 | None |
| A0A218XIS2 | 134-205 | None |
| A0A5J4YHQ7 | 183-263 | None |
| A0A2N2TM58 | 43-115 | None |
| A0A7Y1XRT0 | 47-118 | None |
| A0A811QXJ8 | 561-632 | None |
| A0A7Z8VHK8 | 28-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.