DPCstruct | MC7700
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 68 ± 5 aa |
| Standard deviation of domain lengths | 4.55 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 40.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A062GNI7 | 8-74 | IASKQRAIELGYEPIEAPEAFGGEVFIKNGFKWIHDISFLKQSLNVQTDKALENLGYNVDDYYDYNS |
| A0A7L5JLY4 | 24-85 | SELLAIKNGFEVVFDEDAYNGRYFIKDGKKWIHNIEALKRQLRVNSDSELSEYDYDVVAYYE |
| A0A486N9J0 | 6-69 | None |
| A0A062BRD0 | 8-73 | None |
| A0A3A8EZ50 | 8-83 | None |
| A0A2L0PLN8 | 4-69 | None |
| A0A077DIB5 | 125-195 | None |
| C8N6V1 | 8-71 | None |
| A0A448JWR0 | 19-93 | None |
| A0A5B0B9Y3 | 5-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.