DPCstruct | MC77
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 90 ± 10 aa |
| Standard deviation of domain lengths | 9.55 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M6Y7V7 | 1-78 | MAAIPGAVPVGGFIGPTDDTDVYPTIDPLYGVDGLRSVPDHATRDAIPPLRRRAGMVVVTQNDLQGWQLAGDLVTWVP |
| A0A841EJX1 | 1-99 | MEETTGTVVYGPVTRANPQDKYATGFANFQKGGHHSKLTIQERDAIFSEVREEGMTCFVKEDKITYILDGGLTNNFWRPESVKADFE… |
| A0A7G6YKI3 | 1-93 | None |
| A0A1Y6D585 | 1-79 | None |
| A0A2M8G034 | 5-90 | None |
| A0A2T5TZK4 | 1-99 | None |
| A0A4R6IWE0 | 16-119 | None |
| A0A7D4PRT2 | 1-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.