DPCstruct | MC7699
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 75 ± 9 aa |
| Standard deviation of domain lengths | 8.97 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 33.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07867 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9SF80 | 4-71 | SYEQLIKRVQRIIGSPGAQTKLSAEIKKQHDEDADDWAQMLSELGTVENVTLTPMDDNADHVSIKWNP |
| A0A5E7SRY2 | 10-79 | AYVRMGLRVQKIINSPTAQKAKAALIFRLPDEPVDEWERLLEEIDENDNVTLAYRDDGGVQVFWVVPKED |
| A0A1M6UER3 | 5-100 | None |
| A0A3S0WLF8 | 22-95 | None |
| A0A367M2I6 | 1-85 | None |
| A0A7X1YBH5 | 3-73 | None |
| A0A3M6F0F1 | 37-109 | None |
| A0A0Q0CHI0 | 96-177 | None |
| A0A1Q9YA64 | 15-90 | None |
| A0A2D2MDM1 | 2-59 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.