DPCstruct | MC7698
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 104 ± 14 aa |
| Standard deviation of domain lengths | 13.99 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 37.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0AH03 | 10-87 | IPIYVKARGLFNNHEVLTDVELKWETCQEAELKKFLVEDMGFNAERVAGQIEKLKKSIKATAKPQMRMDSFFKPKAAP |
| K8YVW5 | 3-107 | AYVMARALFVQPEIHDPAELNFKWVEPNEAGLEAFLIDSLGFNPDRVKSGIAKLKASRGAMQQKRLDSFFKPSGSSSTSSTTLKRKE… |
| A0A7J6W6H8 | 1-97 | None |
| A0A1X1BPM6 | 1-129 | None |
| A0A3Q0J557 | 353-442 | None |
| E2LK59 | 54-160 | None |
| A0A7R9HHN5 | 387-498 | None |
| A0A0C3EET9 | 66-169 | None |
| J9E160 | 1-90 | None |
| A0A1I8FBN3 | 157-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.