DPCstruct | MC7696
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 171 ± 20 aa |
| Standard deviation of domain lengths | 19.89 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q6ASF8 | 22-184 | MTGRYSTVLVQERAEIFERRSGNVFAILDEVAALEGAPGARPSLTKPPAMFVRPPLTGLWHKHYNQASFLHQNVSNHWRANDFAVHA… |
| A0A2S1FI37 | 6-149 | AKIIAEVRLLEGYGRHTGTKEAALFDELPLRGLWHKHYLADNSLAKNLQLALGGPKLKRLRGLIEEQRKPGATHLLPEDVPGIARAI… |
| A0A2N5L9U9 | 31-207 | None |
| R6JTF5 | 14-202 | None |
| A0A3R8U8Q8 | 4-171 | None |
| A0A5C7W0T5 | 3-157 | None |
| A0A223N2Y2 | 1-127 | None |
| A0A1I4AGJ8 | 25-214 | None |
| A0A1Q3K152 | 25-217 | None |
| A0A2R3H0L2 | 9-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.