DPCstruct | MC7695
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 56 ± 5 aa |
| Standard deviation of domain lengths | 5.35 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 37.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6MAH7 | 1-50 | MPNTIKLKRSSSAGSAPTSGNLSDGEIALNTADKILYFKDSSGNVKQVKD |
| A0A315DSX3 | 1-64 | MPNTILHKRSSTAAAVPTAAQVTLGELVLNVADGKIYLKRADGVIVTFEPGYVPGQGNSAPMWK |
| A0A2E8NV89 | 1-52 | None |
| A0A2D9CF80 | 1-52 | None |
| C5JBE7 | 1-66 | None |
| A0A2W2BD33 | 1-62 | None |
| A0A2E5RHE2 | 2-52 | None |
| A0A1H9XDQ5 | 1-54 | None |
| A0A2V1P0S9 | 1-53 | None |
| A0A482UDA8 | 1-54 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.