DPCstruct | MC7694
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 151 ± 15 aa |
| Standard deviation of domain lengths | 14.82 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A496KQK1 | 1-153 | QALEKGHEEQEEVETKVSFGGSFLERIQPQKREKIYTLSAQGQVEAGTNRLLWTLRIGLVDSQKYYVIRDIPLFLKVLVHRKPYMIG… |
| F9PW00 | 1-152 | MEYYLKNDQLGQEILLNLETNQEEKETVETQVTFGGEFLKSIQLPRQSNIYQLSAQGQVEAGTNRIIWTLRIGLSKQEKFYVIRDIP… |
| A4XII8 | 1-149 | None |
| A0A6P1ML06 | 5-162 | None |
| A0A3D1PK19 | 12-181 | None |
| R9RCN0 | 131-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.