DPCstruct | MC7691
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 115 ± 9 aa |
| Standard deviation of domain lengths | 8.52 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 45.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8BCC4 | 115-237 | FKNNCNQCTCRRNPSNPNQAELRCTDEVCLVQPDMIQLVNNGNYGWKAANYSFFWGKTLNDGVKYRLGTMPPSDQVLNMNPIIMDSV… |
| A0A5B7K5R3 | 15-125 | GSSCEDGRLTCEEDQCLVDEELIRRMHQHPLRHGWTAANHSIFWGRKLKEGMELRTGTFLPEAMTYNMMPILLRPNPQRIPMEFDAR… |
| A0A1E1WMM7 | 106-222 | None |
| G0P7Q9 | 109-199 | None |
| L9JHT2 | 683-798 | None |
| A0A3P8ANS9 | 25-140 | None |
| A0A7J5XA26 | 124-240 | None |
| A0A401PUT5 | 5-114 | None |
| A0A6J3PYD7 | 20-135 | None |
| C3YBL5 | 127-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.