DPCstruct | MC769
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 75 ± 11 aa |
| Standard deviation of domain lengths | 11.09 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 24.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03958 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A0IN03 | 109-170 | PVVVRVFTLKFRRAEDAAALVRPLLSENGSVLLHARPNTLTVRDVAPAVQRTAQALSSFDVP |
| A0A7Z9KR54 | 77-162 | EKPRKHLKIIHLKYAHAGNLAEIISAFLSEDGVVVDDQDTNSVVVRDTGGGVETAIAIIKALDIPKARKHRHEPQERKEHEEDEAE |
| A0A7C2RK06 | 159-225 | None |
| A0A2E3UW24 | 556-643 | None |
| A6GHB7 | 771-848 | None |
| A0A6L5C9L1 | 306-383 | None |
| A0A377INT7 | 92-171 | None |
| A0A2V7WSR7 | 466-548 | None |
| A0A317ZCS2 | 186-248 | None |
| A0A381GBS6 | 34-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.