DPCstruct | MC7688
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 342 ± 76 aa |
| Standard deviation of domain lengths | 75.70 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 76.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05346 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453H7R8 | 3-294 | DISLIYHVIRGQGTIKLYVVYNVLEIFDKLCQSFGEDVLQVLFNSAEGLSTCSTDRVTFELLRFLLDGAIAVLAFVVHSFVLLAQAI… |
| A0A150G4V9 | 297-513 | YDMVCLGLLCCATAVLRAVRPGSIYYWLKDITSEFLKMSVLSTAFDMLDKILSNFGNDVLEALSGTCTQWLAGRKRGLQLAADAGVA… |
| A0A813F1I3 | 184-526 | None |
| I4YAU8 | 16-337 | None |
| A0A7S0A0T7 | 82-465 | None |
| A0A0V0R0S6 | 340-694 | None |
| A0A811MSC5 | 270-595 | None |
| A0A0M8N8C3 | 17-494 | None |
| A0A445I6K8 | 202-542 | None |
| J4CCU4 | 196-498 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.