DPCstruct | MC7687
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 67 ± 15 aa |
| Standard deviation of domain lengths | 14.96 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 86.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 80.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00421 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4N2W3 | 6-53 | VACFGFGTFHVTGLYGPGIWVSDPYGLTGRVQPVNPAWGVEGFDPFVP |
| A0A453H6Q6 | 1-73 | MALYELAVFDPSDPVLDPVWRQGVACFGFEAFHVMGLYGPGIWVSDPYGLTGKVQAVNLAWGAEGFDPFVPGG |
| A0A0D3GJW3 | 17-72 | None |
| A0A814RG48 | 140-195 | None |
| A0A287U567 | 2-55 | None |
| A0A7J8MUT9 | 31-83 | None |
| A0A2G3BYK9 | 5-95 | None |
| A0A7J9HTE2 | 36-87 | None |
| A0A6V7NEV5 | 18-71 | None |
| A0A1R3KJE0 | 16-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.