DPCstruct | MC7686
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 53 ± 1 aa |
| Standard deviation of domain lengths | 1.13 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 91.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 84.39 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | PF00223- PF00421 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1NHN7 | 189-241 | MPTFFETFPVVLVDEEGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSY |
| A0A453H6E5 | 1-53 | MPTFFETFPVVLVDEEGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGIWM |
| A0A6A4N2W3 | 217-269 | None |
| A0A7J9KP56 | 129-176 | None |
| A0A396I2B3 | 1-52 | None |
| A0A830C908 | 129-181 | None |
| A0A453N3H7 | 16-68 | None |
| A0A2G3D3G0 | 30-82 | None |
| A0A1S4AEF0 | 70-122 | None |
| A0A814RG48 | 359-411 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.