DPCstruct | MC7685
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 113 ± 13 aa |
| Standard deviation of domain lengths | 13.43 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 53.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C0P478 | 74-190 | GGYVYRSMTDPCLNGRYLYADLYAKSMWAGTETPEGSGVYNVSTMAFGCSKSSPIPCDFAAGSSLPSLGYIFSFGEDNAKDVYLLTS… |
| A0A453H484 | 2-104 | WTGLETPPSSGNYTSTLTPFSCSKNSPIPCESAGGAGAGAALPSLGYIFSFGEDNRKDVFVLASKGVYRVVRPSLCGYTCAAEKPAT… |
| A0A0D3D0Q2 | 15-116 | None |
| A0A0R0JZF2 | 170-299 | None |
| A0A0R0JXR6 | 67-155 | None |
| A0A6J0LG33 | 208-327 | None |
| A0A7J6VH56 | 1116-1226 | None |
| A0A1S4B3Z3 | 73-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.