DPCstruct | MC7684
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 299 ± 43 aa |
| Standard deviation of domain lengths | 42.87 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 72.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 42.00 |
| Pfam Score | 96.78 |
| Assigned Pfam label(s) | CL0179- CL0071 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V1AC72 | 522-752 | MVSVIRHADRTPKQKFKYSFRSPLFISLLKGHKEEVIIRAVPDLQVVLETVKIAEEKELEDLKKLKQLRMALEKKMEFPGTKIQLKP… |
| A0A453H3N9 | 6-297 | LDAKAPHLSSTIPPTLPWKSKAPEGLTRQGSGIIGTFGQSEELRCVVVVIRHGDRTPKQKVKLKVTEEKLLNLMLKYNGGKPRAETK… |
| A0A453FNN8 | 261-553 | None |
| A0A7S1FV16 | 312-654 | None |
| A0A816GFX4 | 3-291 | None |
| A0A833YCV9 | 322-610 | None |
| A0A287N067 | 113-383 | None |
| A0A034WJC4 | 63-346 | None |
| A0A1D6NA38 | 102-428 | None |
| A0A183W5Z4 | 154-518 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.