DPCstruct | MC7682
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 79 ± 9 aa |
| Standard deviation of domain lengths | 8.79 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0568 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K4AL85 | 78-147 | VVKIGPWGGEGGLHWDIPAMATPLRLDSITVCSSLAVVDAISFRYWDAQGVKHDAGPWGGNDGDPYVIAL |
| A0A453GZN9 | 13-93 | MGQGQSPSPVVKLGAWGSDAGAAHDIDVTAAAPHRLESIVVRWGKVIDSVAFTYTDEGGQLHTAGPWGGAGGVEEDTVSSF |
| A0A1E5USD3 | 44-118 | None |
| A0A445IEN7 | 336-423 | None |
| A0A453DHE2 | 53-135 | None |
| A0A287XSY0 | 2-72 | None |
| A0A287QDB4 | 167-261 | None |
| A0A6S7MZ78 | 1066-1140 | None |
| A0A1Z5RJH9 | 293-373 | None |
| A0A0E0JIA7 | 4-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.