DPCstruct | MC768
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 96 ± 10 aa |
| Standard deviation of domain lengths | 9.72 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N9N226 | 1-95 | MLAGSYRRSPVTNGWHEGRIVIEKAGLRWTNNANASWELTPDLGRLALRTGPGNPYYRNDPDGGAFEIVLRRGASGEYLPEVAGFKF… |
| A0A7Z9FZS7 | 9-96 | ILGTYRRLPVENPWHIGTISYKNDSEKVLQWTNKAGVSWDIFADFDQNILKTGDDNPYFDSGLREFKLKNRGGEVTGFTFGSDFFSRQ |
| A0A381ZCQ1 | 557-650 | None |
| A0A2P1UAV9 | 372-474 | None |
| A0A6L8LBQ5 | 202-311 | None |
| A0A2E4VBY6 | 2-118 | None |
| A0A6A5KCW5 | 8-122 | None |
| A0A7M5VB52 | 216-301 | None |
| A0A6L3F3G1 | 61-148 | None |
| A0A3M1CWG7 | 233-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.