DPCstruct | MC7679
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 145 ± 25 aa |
| Standard deviation of domain lengths | 25.43 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 75.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 38.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11443 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453GY56 | 71-213 | YSDSDDDEPQRKPTAHAPAATGRALAYASSGDPCVDFFFQVVPGATAAADVAALLGVAWAADARTALRLVCHLRGVRGLGKADREGF… |
| A0A1S4D988 | 9-129 | ATSLSTGNPCLDFFFHVVPNTPPQELLKRLELSWKRDALTTLKLICNLRGVRGTGKSDKEGFYTASLWLHNYHPKTLACNIKAIADF… |
| A0A7R9KDJ1 | 1-140 | None |
| A0A835IKC1 | 29-154 | None |
| A0A835IHT7 | 2-124 | None |
| A0A341KMS4 | 40-169 | None |
| A0A7N2L4W5 | 47-221 | None |
| A0A4Y7JE34 | 19-153 | None |
| A0A540KEY2 | 36-216 | None |
| A0A5N5HP21 | 2-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.