DPCstruct | MC7678
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 116 ± 8 aa |
| Standard deviation of domain lengths | 8.31 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 43.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446SD94 | 211-326 | TWYKELDGVHFEIWCRVTEKQMSFRDALAEVCALNRFPLRQRRMEGALKRDYTMERLESEYHTCTAKVPPGTEKDKAKELIAKAVKN… |
| A0A453GTT2 | 7-109 | YLAFVKDLDSVFFEIWKLVNRQQMSFRDAMEHVYKENPFPLRKRDLEHELSHPVSLGLEEEFRRCTEGISEECDLPRRYVHYARKKL… |
| A0A452XF46 | 59-179 | None |
| A0A3L6SMQ6 | 76-190 | None |
| C7IXL1 | 1-114 | None |
| Q5JLF3 | 429-549 | None |
| A0A0E0JU08 | 105-219 | None |
| A0A446JWI7 | 160-272 | None |
| A0A4U6U2X3 | 352-471 | None |
| R7W6M7 | 261-378 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.