DPCstruct | MC7677
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 68 ± 5 aa |
| Standard deviation of domain lengths | 4.93 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 72.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 56.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835S224 | 146-213 | CGGCIMRVWHHGSALRPCKCPICRRIITLLIPTEATRSLRHETESTQVLENIEKYNRLFGGSSHSFMQ |
| A0A6A1UWG3 | 30-97 | CGNCIMLVWHHGSALQPCKCPLCRRQITLLVPGGASLRQRHDPQVAEILGKVETYNRLFGGRSNGVIQ |
| A0A2U1NEY6 | 342-419 | None |
| A0A251VS37 | 1-69 | None |
| A0A6D2KHE4 | 1-61 | None |
| A0A453MEE8 | 2-69 | None |
| A0A803M522 | 17-80 | None |
| A0A5N5J3W4 | 77-141 | None |
| A0A0E0P3N8 | 538-605 | None |
| A0A4S4CWH6 | 20-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.