DPCstruct | MC7676
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 76 ± 15 aa |
| Standard deviation of domain lengths | 14.97 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 73.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 45.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453GMB7 | 15-86 | LLRNKKRKAELWRNLVDSPQSWWDNRADKRSPKAPDFKHKDTGEALWLSPKTPSWVTDALPPVKGGSKGARR |
| A0A287SAL0 | 4-63 | GKYGEYVALWQAFFANPLDWWDNRKDKKNPRYPDFKHKSTGEALWVEGRNNPNWVVSQLA |
| A0A0B2P204 | 1-76 | None |
| A0A445A762 | 65-144 | None |
| K4AGW7 | 5-70 | None |
| A0A5N6NAU6 | 60-125 | None |
| A0A7N2KL81 | 356-430 | None |
| A0A2K1J2Q1 | 3-72 | None |
| A0A0B2Q1K4 | 98-180 | None |
| A0A6P5SZQ8 | 339-422 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.