DPCstruct | MC7675
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 99 ± 14 aa |
| Standard deviation of domain lengths | 14.17 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 45.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D2AD73 | 369-450 | ELLFVCPGDKNGVTYWLATQGGQQQWVNPMLSGRVKVQASSPACRSTNPASCVALGPPRLNFAAPRSEAGRLVSWWSLDLGP |
| A0A7S0WTL4 | 2-94 | RFAQLRRARHKELVLMDDQQLTGALYHIGTAYGSSAFRNPVVTNEVKITASSPVSRFTDPRRLASRTFSPVSYASPHLHESGAISTY… |
| I0Z6V0 | 263-347 | None |
| A0A7J7N4B1 | 51-143 | None |
| A0A178VN15 | 125-221 | None |
| A0A7J7LF63 | 1-105 | None |
| A0A383V8S8 | 504-631 | None |
| A0A1J3JLT4 | 569-680 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.