DPCstruct | MC7674
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 64 ± 4 aa |
| Standard deviation of domain lengths | 4.49 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 71.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 62.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453MZ93 | 51-112 | RREGREICSEHVNHQTHPITEVRRHHRLDSDEANHLDAYSESRSVIGDGECFYRSFIFSYLV |
| A0A453GJ43 | 1-72 | FFHGESPGYVHYSQHVNHQTHPITEVRKYYLVSDLATGQGVDHLDAYSKFRPVTGDGECFYRSFIFSYLVIN |
| A0A453MZI8 | 220-276 | None |
| A0A287TB90 | 144-207 | None |
| A0A287TAY8 | 92-155 | None |
| A0A287TAX7 | 50-109 | None |
| A0A287TDA5 | 83-144 | None |
| A0A287MH92 | 21-83 | None |
| A0A453GIW2 | 195-258 | None |
| A0A804PJB4 | 68-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.