DPCstruct | MC7673
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 58 ± 5 aa |
| Standard deviation of domain lengths | 4.78 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 55.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453GIQ4 | 7-60 | AGADPNVPDEFGRMPIEFAAICGTREDVEILFPLTSRIPAVRDWSVNGIIYHAY |
| A0A446TJA4 | 42-101 | MRFLLDAGANPNIPDECGNTPIEVAASKGSRDMVEMLFPLTSPVSTLPNWSIDGIISHVK |
| B8A2S8 | 105-169 | None |
| A0A452XGR1 | 63-122 | None |
| A0A453EAP9 | 51-115 | None |
| A0A453EAN7 | 2-48 | None |
| A0A453EAH7 | 35-90 | None |
| A0A453HUN6 | 70-130 | None |
| A0A453HJR2 | 3-54 | None |
| A0A453MLP4 | 81-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.