DPCstruct | MC7672
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 79 ± 3 aa |
| Standard deviation of domain lengths | 3.33 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 75.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 65.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L9U578 | 45-122 | PGEWMPMEKLHAELLEQYSSVWHHSRVRRYLTSEDWPGPESKGKPWYGLLMLLRKYPEHFVINTRSKGRVTLEFVSLV |
| A0A453GI51 | 1-76 | MPMRKLHTELVDRFGNVWHHTRVRKYLTWEEWSPIIAKGRPWFGLLELLRKHPEHFVINTKWKGRAISEFVSLVSL |
| A0A7J6FA64 | 568-654 | None |
| A0A4U6W8R7 | 119-197 | None |
| A0A0A9VBL6 | 13-96 | None |
| A0A5J5BKB0 | 214-290 | None |
| A0A803LNL8 | 168-245 | None |
| A0A0B0PKL8 | 362-438 | None |
| A0A834HHI1 | 14-94 | None |
| R7WA35 | 669-746 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.