DPCstruct | MC7670
Metacluster Properties and Pfam Annotations
| Number of structural domains | 83 |
|---|---|
| Mean domain length (aa) | 86 ± 10 aa |
| Standard deviation of domain lengths | 10.02 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 44.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0405 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U8FFM5 | 10-95 | LINSELWHACAGPLVTLPQVGSLVYYFPQGHSEQVAVSTNRTATSQIPNYPNLAPQLLCQVHNVTLHADKETDEIYAQMSLQPVNS |
| A0A453GEF9 | 8-94 | ELWHACAGPLVTVPRVGDLVFYFPQGHIEQVEASMNQVAGNQMRLYDLPSKLLCRVINVELKAEADTDEVYAQVMLMPEPEVSSTVN |
| A0A5N6Q2D9 | 13-101 | None |
| A0A0B2QBF5 | 7-80 | None |
| A0A0B2PA99 | 8-85 | None |
| Q8H506 | 2-98 | None |
| A0A803QIT3 | 25-108 | None |
| A0A2G3CY47 | 5-68 | None |
| A0A6P8CFE5 | 146-245 | None |
| A0A251SS81 | 1-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.