DPCstruct | MC767
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 121 ± 6 aa |
| Standard deviation of domain lengths | 6.45 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z9FYI1 | 19-142 | TIALQVEFIVERLQAVLPKILESASNPNHIRRQFFRVAESPMGFYALTDYVNFKGEGVLRSERYNGEGWGLLQVLELMSELNSNEAV… |
| A0A7C5WU31 | 5-141 | KSTMSYQAEFMADRLDKALPQMLETINDPKRKALVKKRFYEVMYNGNGTVNERGLYILLDYTNFKGEGTLKSERYKGQGWGLLQVLE… |
| A0A484HNZ0 | 5-115 | None |
| A0A7V7VPC7 | 184-300 | None |
| A0A7C5GMU6 | 210-330 | None |
| F6DCD2 | 149-272 | None |
| A0A7R8L8C6 | 361-478 | None |
| A0A1P8KQY6 | 83-213 | None |
| A0A259LTC4 | 187-309 | None |
| A0A212KSH0 | 522-643 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.