DPCstruct | MC7669
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 94 ± 5 aa |
| Standard deviation of domain lengths | 4.58 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 74.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.67 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 46.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08766 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P5XLM8 | 113-197 | KRKVKPSDYELRTTICGILKEVDFNTVTFTDILKLLVQRFDTDLTPRKLSTKLMIQEELTKLADDEDGEEDGEKDGAQSAGQELE |
| A0A453GDJ8 | 1-97 | GKGKVAPTTKQLHGVVSNILKEVDFNTATLADILRKLGDHFDMDLMDRKSEVKRIIEEVINSMSDDEGEEENEEEDAEENGKKEEDS… |
| A0A4P1R6M3 | 665-752 | None |
| A0A0A0L2T2 | 171-260 | None |
| A0A6A3CC71 | 201-297 | None |
| A0A1U8NFF0 | 11-95 | None |
| A0A1D6GLW8 | 320-412 | None |
| A0A2G5ERN2 | 358-452 | None |
| A0A2U1QH52 | 607-702 | None |
| A0A6A2XIA0 | 474-562 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.