DPCstruct | MC7668
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 188 ± 12 aa |
| Standard deviation of domain lengths | 12.40 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 37.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9XFD5 | 91-284 | IRTHNNLYMPEMVAKLGDTFAKAFDMLEVEKNAILGLPQPLLELYDSPVYKTVLERMQGFFCTLYDNCFHILGSAGSSMQQDFYVVE… |
| A0A453GD63 | 14-208 | AYDLPEIVRRAKLMSTMEISTFLAENNTLPDNDGVDAIRVDAIGTCLRKIRETGYNVIGLCANVGRSIFELDSSLFNHALVADISIM… |
| A0A7J8YLD0 | 149-344 | None |
| A0A446NFT4 | 152-343 | None |
| A0A446NFF1 | 145-336 | None |
| A0A446U2T4 | 95-295 | None |
| A0A2D4HY16 | 4-187 | None |
| A0A287MDC6 | 748-941 | None |
| A0A7F8QF80 | 3-196 | None |
| A0A368RTM5 | 355-538 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.